- MIG2/Kindlin-2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87884
- MIG2/Kindlin-2
- UNC112, KIND2, mig-2, MIG2, UNC112B, PLEKHC1
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: MADSSYNLEV QNILSFLKMQ HLNPDPQLIP EQITTDITPE CLVSPRYLKK YKNKQITARI LEA
- Human
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- FERM domain containing kindlin 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 78 kDa
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEA
Specifications/Features
Available conjugates: Unconjugated